AibGenesis™ Mouse Anti-OR4L1 Antibody (CBMOAB-53490FYA)


Cat: CBMOAB-53490FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53490FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus) WB, ELISA MO53490FYA 100 µg
MO-AB-08202W Monoclonal Cat (Felis catus) WB, ELISA MO08202W 100 µg
MO-AB-09134Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09134Y 100 µg
MO-AB-42227W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42227W 100 µg
MO-AB-45889W Monoclonal Horse (Equus caballus) WB, ELISA MO45889W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus)
CloneMO53490FYA
SpecificityThis antibody binds to Rhesus OR4L1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus OR4L1 Antibody is a mouse antibody against OR4L1. It can be used for OR4L1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR4L1
UniProt IDF7GI80
Protein RefseqThe length of the protein is 296 amino acids long.
The sequence is show below: VSEFILLGLSSSQEIQILFFAIFLHMYVAIVVGNLLIVITVIFDSHLHSPMYFLLANLSFFDLCFSSVVTPKVIADFLRKRKAISLWGCMTQMFFMHFFGGGEMSLLIAMAIDRYVAICKPLHYKTIMNHRVLTVFLLFSWTIGFIHTTSQMAFTVGLPFCGPNVVDSIFCDLPLVIKLACTETYTLELLVIADSGLLSVFCFILLLISYIIMLVTIWQHSSSASSKAVSTLSAHITVVTLFFGPAIFIYAFPFNSFSVDKFLSVFYSIITPFLNPIIYTLRNQEMKAAIKRLNKQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry