AibGenesis™ Mouse Anti-OR4Q3 Antibody (CBMOAB-53496FYA)


Cat: CBMOAB-53496FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53496FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Gorilla, Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Sheep (Ovis aries) WB, ELISA MO53496FYA 100 µg
MO-AB-07357W Monoclonal Cat (Felis catus) WB, ELISA MO07357W 100 µg
MO-AB-16514Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16514Y 100 µg
MO-AB-17260R Monoclonal Cattle (Bos taurus) WB, ELISA MO17260R 100 µg
MO-AB-23554H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23554C 100 µg
MO-AB-35278W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35278W 100 µg
MO-AB-38665W Monoclonal Gorilla WB, ELISA MO38665W 100 µg
MO-AB-45891W Monoclonal Horse (Equus caballus) WB, ELISA MO45891W 100 µg
MO-AB-60670W Monoclonal Marmoset WB, ELISA MO60670W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Gorilla, Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Sheep (Ovis aries)
CloneMO53496FYA
SpecificityThis antibody binds to Rhesus OR4Q3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR4Q3 Antibody is a mouse antibody against OR4Q3. It can be used for OR4Q3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR4Q3
UniProt IDF6U4S7
Protein RefseqThe length of the protein is 313 amino acids long.
The sequence is show below: MKKEQDSNVTEFVLLGLSSSWELQLFLFLLFLFFYIAIVLGNLLIVVTVQVHAHLLQSPMYYFLGHLSFIDLCLSCVTVPKMLEDFLQQSKSISFSGCLTQIYFLHFLGASEMFLLTVMAYDRYVAICNPLRYLTIMNPQLCLWLVLACWCGGFIHSIMQIILVIQLPFCGPNELDNFYCDVPQVIKLACMDTYVVEVLMIANSGLLSLVCFLVLLFSYAIILITLRTHFRQGQNKVLSTCASHLTVVSLIFMPCIFIYLRPFCSFSVDKIFSVFYTVITPMLNPLIYTLRNADMKTAMKKLRIKPCGIPLLC.
For Research Use Only | Not For Clinical Use.
Online Inquiry