AibGenesis™ Mouse Anti-OR5A1 Antibody (CBMOAB-53520FYA)


Cat: CBMOAB-53520FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53520FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO53520FYA 100 µg
Inquiry
MO-AB-00985L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00985L 100 µg
Inquiry
MO-AB-07323W Monoclonal Cat (Felis catus) WB, ELISA MO07323W 100 µg
Inquiry
MO-AB-09182Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09182Y 100 µg
Inquiry
MO-AB-16537Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16537Y 100 µg
Inquiry
MO-AB-17285R Monoclonal Cattle (Bos taurus) WB, ELISA MO17285R 100 µg
Inquiry
MO-AB-23983W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23983W 100 µg
Inquiry
MO-AB-32542W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32542W 100 µg
Inquiry
MO-AB-35301W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35301W 100 µg
Inquiry
MO-AB-45909W Monoclonal Horse (Equus caballus) WB, ELISA MO45909W 100 µg
Inquiry
MO-AB-60708W Monoclonal Marmoset WB, ELISA MO60708W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO53520FYA
SpecificityThis antibody binds to Rhesus OR5A1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR5A1 Antibody is a mouse antibody against OR5A1. It can be used for OR5A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOR5A1
UniProt IDF7C735
Protein RefseqThe length of the protein is 308 amino acids long.
The sequence is show below: MSITKPWNSSSVTTFILRGFTDHPELQALLFVTFLGIYLTTLAWNLALIFLIRGNTHLHTPMYFFLSNLSFIDICYSSAVAPKMLTDFFWEQKTISFVGCAAQFFFFVGMGLSECLLLTAMAYDRLLYPTIMTQGLCTRMVAGAYVGGFLSSLIQASSIFRLHFCGPNIINHFFCDLPPVLALSCSDTFLSQVVNFLVVVTVGGTSFLQLLISYGYIVSAVLKIPSAEGRWKAFNTCASHLMVVTLLFGTALFMYLRPSSTYSLGRDKVVSVFYSLVIPMLNPLIYSLRNKEIKDALWKVLERKKVFS.
For Research Use Only | Not For Clinical Use.
Online Inquiry