AibGenesis™ Mouse Anti-OR6C1 Antibody (CBMOAB-53541FYA)


Cat: CBMOAB-53541FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53541FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Gorilla, Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO53541FYA 100 µg
MO-AB-04919W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04919W 100 µg
MO-AB-09200Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09200Y 100 µg
MO-AB-16548Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16548Y 100 µg
MO-AB-17302R Monoclonal Cattle (Bos taurus) WB, ELISA MO17302R 100 µg
MO-AB-22770W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22770W 100 µg
MO-AB-38680W Monoclonal Gorilla WB, ELISA MO38680W 100 µg
MO-AB-60718W Monoclonal Marmoset WB, ELISA MO60718W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Gorilla, Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO53541FYA
SpecificityThis antibody binds to Rhesus OR6C1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR6C1 Antibody is a mouse antibody against OR6C1. It can be used for OR6C1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR6C1
UniProt IDF7HKY2
Protein RefseqThe length of the protein is 302 amino acids long.
The sequence is show below: MRNHTEITEFILLGLTDDPKFQVVIFVFLLITYMLSVTGNLTIITLTLLDSHLQTPMYFFLRNFSILEISFTTVSIPKFLGNIISGDKTISFNDCIVQLFFFILLGVTEFYLLAAMSYDRYVAIXXXXXXXLVFTSWLVSFLIIFPALMLLLKLDYCRSNIMDHFTCDYFPLLQLACSDTKFLEVMGFSCAVFTLMLTLALIFLSYIYIIRTILRIPSASQRTKAFSTCSSHMIVISISYGSCIFMYIKPSAKDRVSLSKGVAILNTSVAPMLNPFIYSLRNQQVKQAFINMARKTVFFTST.
For Research Use Only | Not For Clinical Use.
Online Inquiry