AibGenesis™ Mouse Anti-OR6K6 Antibody (CBMOAB-53553FYA)


Cat: CBMOAB-53553FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53553FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO53553FYA 100 µg
Inquiry
MO-AB-09210Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09210Y 100 µg
Inquiry
MO-AB-09701W Monoclonal Cat (Felis catus) WB, ELISA MO09701W 100 µg
Inquiry
MO-AB-16554Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16554Y 100 µg
Inquiry
MO-AB-17310R Monoclonal Cattle (Bos taurus) WB, ELISA MO17310R 100 µg
Inquiry
MO-AB-19391W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19391W 100 µg
Inquiry
MO-AB-27975R Monoclonal Pig (Sus scrofa) WB, ELISA MO27975R 100 µg
Inquiry
MO-AB-32562W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32562W 100 µg
Inquiry
MO-AB-35324W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35324W 100 µg
Inquiry
MO-AB-42244W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42244W 100 µg
Inquiry
MO-AB-45922W Monoclonal Horse (Equus caballus) WB, ELISA MO45922W 100 µg
Inquiry
MO-AB-60722W Monoclonal Marmoset WB, ELISA MO60722W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO53553FYA
SpecificityThis antibody binds to Rhesus OR6K6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR6K6 Antibody is a mouse antibody against OR6K6. It can be used for OR6K6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR6K6
UniProt IDF7HES5
Protein RefseqThe length of the protein is 343 amino acids long.
The sequence is show below: MKQYSVGNQHSNSRSLLFPLLSSQMTQLMASGNQTMVTEFLFSIFLHPQRGGLSFFIPLLLIYGFILTGNLIMFIVIQLDMALHTPMYFFISVLSFLEICYTTTTIPKMLSCLISEQKSISVAGCLLQMYFFHSLGIAEGCILTAMAIDRYLAICNPLRYPAIMTPKLCIQLTVGSCFCGFLLVLPEIAWIATLPFCGSNQIHQIFCDFTPVLSLACTDTSLVVIVDAIHAVEIVASFLVIALSYIRIIMVILGMHSTEGRHKAFSTCAAHLTVFLLFFGSVAVMYLRFSATYSVFWDTAIAVTFVILAPFFNPIIYSLRNKDMKEAIGRLFHYQKRASWAGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry