AibGenesis™ Mouse Anti-OR6N2 Antibody (CBMOAB-53554FYA)


Cat: CBMOAB-53554FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53554FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO53554FYA 100 µg
MO-AB-01003L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01003L 100 µg
MO-AB-09212Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09212Y 100 µg
MO-AB-15247W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15247W 100 µg
MO-AB-16556Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16556Y 100 µg
MO-AB-17312R Monoclonal Cattle (Bos taurus) WB, ELISA MO17312R 100 µg
MO-AB-27976R Monoclonal Pig (Sus scrofa) WB, ELISA MO27976R 100 µg
MO-AB-32566W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32566W 100 µg
MO-AB-35326W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35326W 100 µg
MO-AB-42246W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42246W 100 µg
MO-AB-45925W Monoclonal Horse (Equus caballus) WB, ELISA MO45925W 100 µg
MO-AB-60725W Monoclonal Marmoset WB, ELISA MO60725W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO53554FYA
SpecificityThis antibody binds to Rhesus OR6N2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR6N2 Antibody is a mouse antibody against OR6N2. It can be used for OR6N2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR6N2
UniProt IDF7HES1
Protein RefseqThe length of the protein is 317 amino acids long.
The sequence is show below: MDQHNHSSLAEFVFLGFASVGYVRGWLFVLLLLAYLFTICGNMLIFSVIRLDAALHTPMYHFVSVLSFLELWYTATTIPKMLANILSEKKTISFAGCLLQTYFFHSLGASECYLLTAMAYDRYLAICRPLQYPAIMTTTLCAKMAAACWICGFLCPISEVILVSQLPFCAYNEIQHIFCDFPPLLSLACKDTSTNILVDFATNAFIILITFLFIMFSYARIIGAVLKIKTASGRKKAFSTCASHLAVVLIFFGSIIFMYVRLKKSYSLTLDRTLAVVYSVLTPMVNPIIYSLRNKEVIKGIRRTIFQKRDKASVAHH.
For Research Use Only | Not For Clinical Use.
Online Inquiry