AibGenesis™ Mouse Anti-OR8B8 Antibody (CBMOAB-53564FYA)


Cat: CBMOAB-53564FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53564FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO53564FYA 100 µg
MO-AB-01008L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01008L 100 µg
MO-AB-07778W Monoclonal Cat (Felis catus) WB, ELISA MO07778W 100 µg
MO-AB-09220Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09220Y 100 µg
MO-AB-16563Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16563Y 100 µg
MO-AB-35337W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35337W 100 µg
MO-AB-60732W Monoclonal Marmoset WB, ELISA MO60732W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO53564FYA
SpecificityThis antibody binds to Rhesus OR8B8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR8B8 Antibody is a mouse antibody against OR8B8. It can be used for OR8B8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR8B8
UniProt IDF7HBY7
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: MAAENSSFLTEFILAGLTDQPGVQIPLFFLFLGFYVVTVVGNLGLITLIGLISHLHTPMYFFLYNLSFIDFCYSSVITPKMLMSFVSKKNSISYAGCMTQLFFFLFFVVSESFILSAMAYDRYVAICNPLSYTVTMSPQVCLLLLLGVYGMGFAGAMAHTACMMGVTFCANNLVNHYMCDILPLLERACTSTYVNELVVFVVVGIDIGVPTVTIFISYALILSSILHIRSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSSILPMNQGKVSSLFYTTLVPMLNPLIYSLRNKDVKVALKKILNKNAFS.
For Research Use Only | Not For Clinical Use.
Online Inquiry