AibGenesis™ Mouse Anti-OR8D4 Antibody (CBMOAB-53566FYA)


Cat: CBMOAB-53566FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53566FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Pig (Sus scrofa) WB, ELISA MO53566FYA 100 µg
MO-AB-07317W Monoclonal Cat (Felis catus) WB, ELISA MO07317W 100 µg
MO-AB-17325R Monoclonal Cattle (Bos taurus) WB, ELISA MO17325R 100 µg
MO-AB-18518W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18518W 100 µg
MO-AB-27984R Monoclonal Pig (Sus scrofa) WB, ELISA MO27984R 100 µg
MO-AB-32579W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32579W 100 µg
MO-AB-35339W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35339W 100 µg
MO-AB-42250W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42250W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Pig (Sus scrofa)
CloneMO53566FYA
SpecificityThis antibody binds to Rhesus OR8D4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR8D4 Antibody is a mouse antibody against OR8D4. It can be used for OR8D4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOR8D4
UniProt IDF7HA29
Protein RefseqThe length of the protein is 313 amino acids long.
The sequence is show below: MGIKNHSIVTEFLLSGLTEQPELQLPLFGLFLGIYTITVVGNLGMISIIRLNHQLHIPMYYFLSSLSFLDVCYSSVITPKMLSGFLCRDRSISYSGCMTQLFFFCVCVISECYMLAAMAYDHYVAICNPLLYKVIMSPSVCSLLVAAVFSVGFTDAVIHGGCILRLSFCGSNIIKHYFCDIVPLIKLSCSSAYIDELLIFVIGGFNMVATSLAIIISYAFILTGILRIHSKKGRCKAFSTCSSHLTAVLIFYGSLMSMYLKPAFSSSLTQEKVSSVFYTTVIPMLNPLIYSLRNKEVKNALTKLLRRKIPLSP.
For Research Use Only | Not For Clinical Use.
Online Inquiry