AibGenesis™ Mouse Anti-OR8I2 Antibody (CBMOAB-53570FYA)


Cat: CBMOAB-53570FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53570FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Gorilla, Horse (Equus caballus), Sheep (Ovis aries) WB, ELISA MO53570FYA 100 µg
MO-AB-09222W Monoclonal Cat (Felis catus) WB, ELISA MO09222W 100 µg
MO-AB-12171W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12171W 100 µg
MO-AB-16565Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16565Y 100 µg
MO-AB-38687W Monoclonal Gorilla WB, ELISA MO38687W 100 µg
MO-AB-45933W Monoclonal Horse (Equus caballus) WB, ELISA MO45933W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Gorilla, Horse (Equus caballus), Sheep (Ovis aries)
CloneMO53570FYA
SpecificityThis antibody binds to Rhesus OR8I2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR8I2 Antibody is a mouse antibody against OR8I2. It can be used for OR8I2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR8I2
UniProt IDF7FTU5
Protein RefseqThe length of the protein is 310 amino acids long.
The sequence is show below: MAGNNFTEVTVFILSGFANHPELQVSLFLMFLFIYLFTILGNLGLTMLIRIDSQLHTPMYFFLSNLAFIDILYSSTVTPKALVNFKSNQRSISFVGCFVQMYFFVGLVCSECFLLGSMAYDRYVAICNPLLYSVVMSQKVCNWLGVMPYAIGFTNSLISVCVISSLVFCGSSINHFFCDTTALLALSCVDAFGTEMVIFVLAGFTLLSSLLIITVSYITIISAILRIQSAAGRQKAFSTCTSHLTGVTIFYGSLIFTYLQPDNTSSLTQAQVASVFYTTVIPMLNPLIYSLRNKEVKNAFLRVIHRKLFP.
For Research Use Only | Not For Clinical Use.
Online Inquiry