AibGenesis™ Mouse Anti-OR9Q1 Antibody (CBMOAB-53582FYA)


Cat: CBMOAB-53582FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53582FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus) WB, ELISA MO53582FYA 100 µg
MO-AB-01011L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01011L 100 µg
MO-AB-07671W Monoclonal Cat (Felis catus) WB, ELISA MO07671W 100 µg
MO-AB-09227Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09227Y 100 µg
MO-AB-11745W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11745W 100 µg
MO-AB-27985R Monoclonal Pig (Sus scrofa) WB, ELISA MO27985R 100 µg
MO-AB-60738W Monoclonal Marmoset WB, ELISA MO60738W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus)
CloneMO53582FYA
SpecificityThis antibody binds to Rhesus OR9Q1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR9Q1 Antibody is a mouse antibody against OR9Q1. It can be used for OR9Q1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR9Q1
UniProt IDF7D4Z9
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: MAEMNLTLVTEFLLIAFTENPEWALPLFLLFLFMYLITLLGNLGMIILIRMDRRLHTPMYFLLSHLAFMDICYSSVTVPQTLAVLLEHGAALSYTRCAAQFFLFTFFGSIDCYLLALMAYDRYLAVCQPLLYVTIMTQQICLSLVAGAYVAGLFSALVRTVSAFTLSFCGTNEIDFIFCDLPPLLKLTCGESYTQEVVIIVFAIFVIPASMVVILVSYLFIIVSIMRIPSAGSWAKTFSTCTSHLTAVSLFFGTLIFMYLRGNSGQSLEENRVVSVLYTAVIPMLNPLIYSLRNKEVKESLRKILNRAKLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry