Mouse Anti-P2RX1 Antibody (CBMOAB-53696FYA)


Cat: CBMOAB-53696FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53696FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO53696FYA 100 µg
CBMOAB-91166FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91166FYA 100 µg
MO-AB-04947W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04947W 100 µg
MO-AB-08040W Monoclonal Cat (Felis catus) WB, ELISA MO08040W 100 µg
MO-AB-13426W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13426W 100 µg
MO-AB-35363W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35363W 100 µg
MO-AB-60842W Monoclonal Marmoset WB, ELISA MO60842W 100 µg
MO-AB-17421R Monoclonal Cattle (Bos taurus) WB, ELISA MO17421R 100 µg
MO-AB-01254R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01254R 100 µg
MO-AB-28079R Monoclonal Pig (Sus scrofa) WB, ELISA MO28079R 100 µg
MO-AB-23566H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23566C 100 µg
MO-AB-01035L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01035L 100 µg
MO-AB-17007Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17007Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO53696FYA
SpecificityThis antibody binds to Rhesus P2RX1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Plasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the P2X family of G-protein-coupled receptors. These proteins can form homo-and heterotimers and function as ATP-gated ion channels and mediate rapid and selective permeability to cations. This protein is primarily localized to smooth muscle where binds ATP and mediates synaptic transmission between neurons and from neurons to smooth muscle and may being responsible for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. This protein may also be involved in promoting apoptosis.P2RX1 (Purinergic Receptor P2X 1) is a Protein Coding gene. Diseases associated with P2RX1 include Bleeding Disorder, Platelet-Type, 8 and Neurogenic Bladder. Among its related pathways are Platelet homeostasis and Response to elevated platelet cytosolic Ca2+. Gene Ontology (GO) annotations related to this gene include ion channel activity and calcium channel activity. An important paralog of this gene is P2RX4.Ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Seems to be linked to apoptosis, by increasing the intracellular concentration of calcium in the presence of ATP, leading to programmed cell death. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus P2RX1 Antibody is a mouse antibody against P2RX1. It can be used for P2RX1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesP2X purinoceptor; P2RX1
UniProt IDF7HDR7
Protein RefseqThe length of the protein is 399 amino acids long.
The sequence is show below: MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKDDSGCTPGKAKRKAQGIRTGKCVAFNDTLKTCEIFGWCPAEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAYMKTCLYHKTLHPLCPVFQLGYVVQESGQNFSSLAEKGGVVGITIDWHCDLDWHVRHCKPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNHRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGADERDLAATGSTLGLQENMRTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry