AibGenesis™ Mouse Anti-PATE1 Antibody (CBMOAB-53941FYA)


Cat: CBMOAB-53941FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53941FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO53941FYA 100 µg
MO-AB-27729H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27729C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO53941FYA
SpecificityThis antibody binds to Rhesus PATE1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PATE1 Antibody is a mouse antibody against PATE1. It can be used for PATE1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPATE1
UniProt IDF6V9X3
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: MDKSLLLELPILLCCFRASVSGSLFKRKFADNEIATVEAEFPRQVTEIVQCRMCHLQFPGENCSRGRGICTAGTEEACMVGRISKRDGSPWLTFKDCLKNCADVKGIKWSVYFVSFSCCRSHDLCNEDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry