Mouse Anti-Rhesus PCDHA9 Antibody (MO-AB-05032W)


Cat: MO-AB-05032W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO05032W
SpecificityThis antibody binds to Rhesus PCDHA9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined. (From NCBI)
Product OverviewMouse Anti-Rhesus PCDHA9 Antibody is a mouse antibody against PCDHA9. It can be used for PCDHA9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtocadherin alpha-9 isoform 1; PCDHA9
UniProt IDH9F5D6
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: QQRRQRVCSGEGPPKTDLMAFSPGLSPCAGSTERTGEPSASSDLSGKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNNQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry