Mouse Anti-PCYT2 Antibody (CBMOAB-54076FYA)


Cat: CBMOAB-54076FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54076FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO54076FYA 100 µg
CBMOAB-91935FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91935FYA 100 µg
MO-AB-05060W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05060W 100 µg
MO-AB-06104H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06104C 100 µg
MO-AB-17649R Monoclonal Cattle (Bos taurus) WB, ELISA MO17649R 100 µg
MO-AB-18886W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18886W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO54076FYA
SpecificityThis antibody binds to Rhesus PCYT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that catalyzes the formation of CDP-ethanolamine from CTP and phosphoethanolamine in the Kennedy pathway of phospholipid synthesis. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus PCYT2 Antibody is a mouse antibody against PCYT2. It can be used for PCYT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPCYT2
UniProt IDF6S907
Protein RefseqThe length of the protein is 386 amino acids long.
The sequence is show below: MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLADRPYIIAGLHFDQEVNRYKGKNYPIMNLHERTLSVLACRVRGEVGSPGAVPSCLLEEPQGHLMSHCQQGPSSRSSSPDPQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARRQAAQPLGERDGDF.
For Research Use Only | Not For Clinical Use.
Online Inquiry