AibGenesis™ Mouse Anti-PDHX Antibody (CBMOAB-54166FYA)
Cat: CBMOAB-54166FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-54166FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO54166FYA | 100 µg | ||
| CBMOAB-92061FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO92061FYA | 100 µg | ||
| MO-AB-06138H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06138C | 100 µg | ||
| MO-AB-11129W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11129W | 100 µg | ||
| MO-AB-17707R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17707R | 100 µg | ||
| MO-AB-23583H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23583C | 100 µg | ||
| MO-AB-61228W | Monoclonal | Marmoset | WB, ELISA | MO61228W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO54166FYA |
| Specificity | This antibody binds to Rhesus PDHX. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The pyruvate dehydrogenase (PDH) complex is located in the mitochondrial matrix and catalyzes the conversion of pyruvate to acetyl coenzyme A. The PDH complex thereby links glycolysis to Krebs cycle. The PDH complex contains three catalytic subunits, E1, E2, and E3, two regulatory subunits, E1 kinase and E1 phosphatase, and a non-catalytic subunit, E3 binding protein (E3BP). This gene encodes the E3 binding protein subunit; also known as component X of the pyruvate dehydrogenase complex. This protein tethers E3 dimers to the E2 core of the PDH complex. Defects in this gene are a cause of pyruvate dehydrogenase deficiency which results in neurological dysfunction and lactic acidosis in infancy and early childhood. This protein is also a minor antigen for antimitochondrial antibodies. These autoantibodies are present in nearly 95% of patients with the autoimmune liver disease primary biliary cirrhosis (PBC). In PBC, activated T lymphocytes attack and destroy epithelial cells in the bile duct where this protein is abnormally distributed and overexpressed. PBC eventually leads to cirrhosis and liver failure. Alternative splicing results in multiple transcript variants encoding distinct isoforms. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus PDHX Antibody is a mouse antibody against PDHX. It can be used for PDHX detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | PDHX |
| UniProt ID | F7HS46 |
| Protein Refseq | The length of the protein is 501 amino acids long. The sequence is show below: MAASWRLGCDPRLLRYLVGFPGCRSIGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPRTLRFRLSPAARNILEKHSLDASQGTATGSFSIGSKSKCFKILDMVRTSSIPCLLKVRVEKSVPDASSPLYLTKIPLFYRVIQSPKQTHLWRNYLGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry