AibGenesis™ Mouse Anti-PDZD9 Antibody (CBMOAB-54238FYA)


Cat: CBMOAB-54238FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54238FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO54238FYA 100 µg
MO-AB-17748R Monoclonal Cattle (Bos taurus) WB, ELISA MO17748R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO54238FYA
SpecificityThis antibody binds to Rhesus PDZD9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PDZD9 Antibody is a mouse antibody against PDZD9. It can be used for PDZD9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPDZD9
UniProt IDF7HJV0
Protein RefseqThe length of the protein is 202 amino acids long.
The sequence is show below: MAEGEEEGGDVLISVGYANVLGYTLREFLQLLQHITVGTVLQIKVYRDFINIPEEWLEIYDLIPEAKFPVTSTPKKMELAKDESFTSSDDNENVDLDRRLQYYRYPWSTAHHPARRPISISRDWHGYKKKNHTISVGKDIDCDVMIHRDDKKEVKAPSPYWIMVKQDNETSSSSTSSTSDAFWLEDCAQVEEGKAQPVSKFG.
For Research Use Only | Not For Clinical Use.
Online Inquiry