AibGenesis™ Mouse Anti-PEX11G Antibody (CBMOAB-54296FYA)


Cat: CBMOAB-54296FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54296FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO54296FYA 100 µg
CBMOAB-92229FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92229FYA 100 µg
MO-AB-06184H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06184C 100 µg
MO-AB-13684W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13684W 100 µg
MO-AB-27817H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27817C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO54296FYA
SpecificityThis antibody binds to Rhesus PEX11G.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the PEX11 family. This family is reported to regulate the number and size of peroxisomes in evolutionarily distant organisms. The protein encoded by this gene may induce clustering of peroxisomes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus PEX11G Antibody is a mouse antibody against PEX11G. It can be used for PEX11G detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPeroxisomal membrane protein 11C; PEX11G
UniProt IDH9FGF9
Protein RefseqThe length of the protein is 203 amino acids long.
The sequence is show below: LVGGVLVEQCPTRSEVGTRLLVVSTQLSHCRTILRLFDDLSMFVYTKQYGLGAQEEDAFVRLVSVLGNLADQLYYPCEHVAWAADARVLHVDSSRWWTLSTALWALSLLLGVARSLWMLLKLRQRLRSPTAPFTSPLPRGKRRAMEAQMQSEALSLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARA.
For Research Use Only | Not For Clinical Use.
Online Inquiry