AibGenesis™ Mouse Anti-PLAC9 Antibody (CBMOAB-54679FYA)


Cat: CBMOAB-54679FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54679FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO54679FYA 100 µg
MO-AB-18021R Monoclonal Cattle (Bos taurus) WB, ELISA MO18021R 100 µg
MO-AB-22802W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22802W 100 µg
MO-AB-27920H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27920C 100 µg
MO-AB-61645W Monoclonal Marmoset WB, ELISA MO61645W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO54679FYA
SpecificityThis antibody binds to Rhesus PLAC9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PLAC9 Antibody is a mouse antibody against PLAC9. It can be used for PLAC9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPlacenta-specific protein 9; PLAC9
UniProt IDI0FPY7
Protein RefseqThe length of the protein is 98 amino acids long.
The sequence is show below: MRPLLCALAGLALLRAAGSLAAAEPFSPPRGDSAQSTVCDRHMAVQRRLDVMEEMVEKTVDHLETEVKGLLGLLEELAWNLPPGPFSPAPDLLGEDGF.
For Research Use Only | Not For Clinical Use.
Online Inquiry