AibGenesis™ Mouse Anti-PLBD2 Antibody (CBMOAB-54692FYA)


Cat: CBMOAB-54692FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54692FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO54692FYA 100 µg
MO-AB-05180W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05180W 100 µg
MO-AB-18029R Monoclonal Cattle (Bos taurus) WB, ELISA MO18029R 100 µg
MO-AB-26038W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26038W 100 µg
MO-AB-61653W Monoclonal Marmoset WB, ELISA MO61653W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO54692FYA
SpecificityThis antibody binds to Rhesus PLBD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPutative phospholipase. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus PLBD2 Antibody is a mouse antibody against PLBD2. It can be used for PLBD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPLBD2
UniProt IDF6Z3Z9
Protein RefseqThe length of the protein is 542 amino acids long.
The sequence is show below: MVGQMYCSSGSPLARALTRALALALVLALLVGLFLSGLAGAIPAPGGRWAHDGPVTPASRSRSVLLHAATGQLLLVDGRQPDAVAWANLTNSIHETGWAFLELGTSGGYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSAYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFREGPQGDSPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNIVANRLASDGATWADIFKRLNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACDPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSTSLAR.
For Research Use Only | Not For Clinical Use.
Online Inquiry