Mouse Anti-PLLP Antibody (CBMOAB-54824FYA)
Cat: CBMOAB-54824FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-54824FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO54824FYA | 100 µg | ||
MO-AB-18094R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO18094R | 100 µg | ||
MO-AB-27932H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27932C | 100 µg | ||
MO-AB-35450W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35450W | 100 µg | ||
MO-AB-61767W | Monoclonal | Marmoset | WB, ELISA | MO61767W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus) |
Clone | MO54824FYA |
Specificity | This antibody binds to Rhesus PLLP. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Rhesus PLLP Antibody is a mouse antibody against PLLP. It can be used for PLLP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Plasmolipin; PLLP |
UniProt ID | H9FB69 |
Protein Refseq | The length of the protein is 31 amino acids long. The sequence is show below: IAYGVSAFFSYQAWRGVGSNAATSQMAGGYA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry