AibGenesis™ Mouse Anti-POLR3H Antibody (CBMOAB-55007FYA)


Cat: CBMOAB-55007FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55007FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO55007FYA 100 µg
CBMOAB-93302FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93302FYA 100 µg
MO-AB-17355W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17355W 100 µg
MO-AB-18246R Monoclonal Cattle (Bos taurus) WB, ELISA MO18246R 100 µg
MO-AB-27972H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27972C 100 µg
MO-AB-61967W Monoclonal Marmoset WB, ELISA MO61967W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO55007FYA
SpecificityThis antibody binds to Rhesus POLR3H.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus POLR3H Antibody is a mouse antibody against POLR3H. It can be used for POLR3H detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPOLR3H
UniProt IDF7BKD3
Protein RefseqThe length of the protein is 175 amino acids long.
The sequence is show below: MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVGSISEPGLGLLSWWTSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry