AibGenesis™ Mouse Anti-PPIL3 Antibody (CBMOAB-55106FYA)
Cat: CBMOAB-55106FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-55106FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Goat (Capra hircus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Sheep (Ovis aries), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) | WB, ELISA | MO55106FYA | 100 µg | ||
| CBMOAB-61297FYC | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO61297FYC | 100 µg | ||
| MO-AB-01158L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01158L | 100 µg | ||
| MO-AB-01354R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01354R | 100 µg | ||
| MO-AB-09465Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09465Y | 100 µg | ||
| MO-AB-09599W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09599W | 100 µg | ||
| MO-AB-17199Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17199Y | 100 µg | ||
| MO-AB-18333R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO18333R | 100 µg | ||
| MO-AB-25022W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25022W | 100 µg | ||
| MO-AB-28002H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28002C | 100 µg | ||
| MO-AB-28503R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28503R | 100 µg | ||
| MO-AB-33659H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33659C | 100 µg | ||
| MO-AB-38011W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38011W | 100 µg | ||
| MO-AB-42379W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42379W | 100 µg | ||
| MO-AB-46142W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46142W | 100 µg | ||
| MO-AB-62056W | Monoclonal | Marmoset | WB, ELISA | MO62056W | 100 µg | ||
| MO-DKB-01436W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Goat (Capra hircus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Sheep (Ovis aries), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) |
| Clone | MO55106FYA |
| Specificity | This antibody binds to Rhesus PPIL3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. This protein has protein phosphatase inhibitor activity that can combine actin and protein phosphatase 1. It can participate in actin cytoskeleton reorganization and vasculature development. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Rhesus PPIL3 Antibody is a mouse antibody against PPIL3. It can be used for PPIL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | PPIL3 |
| UniProt ID | F7H434 |
| Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: SVTLHTDVGDIKIEVFCERTPKTCEELEEAAAVYGARSLRMNTVNILSTVLEVLYLWLIMARTPMDLSSSSPMANSHIWT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry