AibGenesis™ Mouse Anti-PQLC3 Antibody (CBMOAB-55262FYA)


Cat: CBMOAB-55262FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55262FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO55262FYA 100 µg
CBMOAB-93768FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93768FYA 100 µg
MO-AB-15548W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15548W 100 µg
MO-AB-28021H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28021C 100 µg
MO-AB-62208W Monoclonal Marmoset WB, ELISA MO62208W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO55262FYA
SpecificityThis antibody binds to Rhesus PQLC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PQLC3 Antibody is a mouse antibody against PQLC3. It can be used for PQLC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPQLC3
UniProt IDF7G8I8
Protein RefseqThe length of the protein is 202 amino acids long.
The sequence is show below: MEAALLGLCNWSTLGVCAALKLPQISAVLAARSARGLSLPSLLLELAGFLVFLRYQCYYGYPPLTYLEYPILIAQDVILLLCIFHFNGNVKQATPYIAVLVSSWFVLALQKWIIDLAMNLCTFISAASKFAQLQCLWKTRDSGTVSALTWSLSSYTCATRIITTLMTTNDFTILTRFVIMLALNIWVTVTVLRYRKTAIKAE.
For Research Use Only | Not For Clinical Use.
Online Inquiry