AibGenesis™ Mouse Anti-PRIMA1 Antibody (CBMOAB-55313FYA)
Cat: CBMOAB-55313FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-55313FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Rat (Rattus norvegicus) | WB, ELISA | MO55313FYA | 100 µg | ||
| MO-AB-03556Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03556Y | 100 µg | ||
| MO-AB-18459R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO18459R | 100 µg | ||
| MO-AB-28038H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28038C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Rat (Rattus norvegicus) |
| Clone | MO55313FYA |
| Specificity | This antibody binds to Rhesus PRIMA1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus PRIMA1 Antibody is a mouse antibody against PRIMA1. It can be used for PRIMA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Proline-rich membrane anchor 1; PRIMA1 |
| UniProt ID | H9F3X8 |
| Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: PPPPRLLSAPAPNSTSCPTEESWWSGLVIIIAVCCASLVFLTVLVIICYKAIKRKPLRKDENGTSVAEYPMSTSQSNKGVDVNNTVV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry