AibGenesis™ Mouse Anti-PRPSAP2 Antibody (CBMOAB-55424FYA)


Cat: CBMOAB-55424FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55424FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO55424FYA 100 µg
CBMOAB-94143FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94143FYA 100 µg
MO-AB-03609Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03609Y 100 µg
MO-AB-17089W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17089W 100 µg
MO-AB-18638R Monoclonal Cattle (Bos taurus) WB, ELISA MO18638R 100 µg
MO-AB-62369W Monoclonal Marmoset WB, ELISA MO62369W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO55424FYA
SpecificityThis antibody binds to Rhesus PRPSAP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRPSAP2 Antibody is a mouse antibody against PRPSAP2. It can be used for PRPSAP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRPSAP2
UniProt IDF7GJM9
Protein RefseqThe length of the protein is 370 amino acids long.
The sequence is show below: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAVILFFILLNVYNVRKEFFFNLCWADYPLTNWLLQRVMTAIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPISLSMQEPGGNMKGRGGGRGLMTFDDLTPYIEWFFKVIRNFQKKQNLSCFALFCYTFLSSPDAPRLIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry