AibGenesis™ Mouse Anti-PRUNE Antibody (CBMOAB-55524FYA)


Cat: CBMOAB-55524FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55524FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO55524FYA 100 µg
CBMOAB-94191FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94191FYA 100 µg
MO-AB-62413W Monoclonal Marmoset WB, ELISA MO62413W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO55524FYA
SpecificityThis antibody binds to Rhesus PRUNE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRUNE Antibody is a mouse antibody against PRUNE. It can be used for PRUNE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRUNE
UniProt IDF7BTY6
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: MDLKIGKATPKDSKYVEKLEALFPDLPKRNDIFDSLQKAKFDVSGLTTEQMLRKDQKTIYRQGVKVAISAVYMDLEICGVLECSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSVYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry