AibGenesis™ Mouse Anti-PTGER1 Antibody (CBMOAB-55664FYA)


Cat: CBMOAB-55664FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55664FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Marmoset WB, ELISA MO55664FYA 100 µg
MO-AB-32957W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32957W 100 µg
MO-AB-62529W Monoclonal Marmoset WB, ELISA MO62529W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris), Marmoset
CloneMO55664FYA
SpecificityThis antibody binds to Rhesus PTGER1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionReceptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(q) proteins which activate a phosphatidylinositol-calcium second messenger system. May play a role as an important modulator of renal function. Implicated the smooth muscle contractile response to PGE2 in various tissues. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus PTGER1 Antibody is a mouse antibody against PTGER1. It can be used for PTGER1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPTGER1
UniProt IDF6TQR8
Protein RefseqThe length of the protein is 410 amino acids long.
The sequence is show below: MRGALGPQRVGCAAVGRFARAAHLLHDAGRRVQPAGAGAAGAGRGPPATPPLGRHLPAVRGQPAGHRPGRPRDPGRASAAPVHCGARSGRRGLPLPGRLHGLLRPVPAAAGLRHGGGALRGRHAAAAPRRAGLGLPRAPGAGRGSCGGLSRRAATAGARGPLRAAVPGHVVLHRPGSLGRLAPGTARRPLRRPRPGRSPRRAGVQHAQRPGPATRPLATPLPRASPGLGPRQPASLGGARTPLGLRLVRLIHRFSLHSLWRLPEPRLGTQSSQPRRGDGGPACRYHGGVVHLLEPNAGVGGAGRRGLEFYLPAAATVPGRAPCLLEPDPGPLGVHPAAPGRAAPTASLPAPEGRGQGRPRGAGPNPERLGGQLAAQLPAQRPQLLLSTTGGPTTKPTHPGAGPRCAAKSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry