AibGenesis™ Mouse Anti-RAI2 Antibody (MO-AB-05510W)


Cat: MO-AB-05510W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05510W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO05510W 100 µg
MO-AB-14700W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14700W 100 µg
MO-AB-62895W Monoclonal Marmoset WB, ELISA MO62895W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO05510W
SpecificityThis antibody binds to Rhesus RAI2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRetinoic acid plays a critical role in development, cellular growth, and differentiation. The specific function of this retinoic acid-induced gene has not yet been determined but it may play a role in development. The chromosomal location of this gene designates it to be a candidate for diseases such as Nance-Horan syndrome, sensorineural deafness, non-specific X-linked cognitive disability, oral-facial-digital syndrome, and Fried syndrome. Alternate splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus RAI2 Antibody is a mouse antibody against RAI2. It can be used for RAI2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRetinoic acid-induced protein 2 isoform 1; RAI2
UniProt IDH9FHU1
Protein RefseqThe length of the protein is 202 amino acids long.
The sequence is show below: NNLFQGAEDSEAQPQLLDLRIPSQPQEPTLPFEAVLQNLFPSQGTLGPPPCQPPPGYAPVPPQPFSSPLSPLVPPATLLVPYPVIVPLPVPVPIPIPIPVPQSSESKFSSSFPKPPSSFGLHSFKGTQTPLEKDELKPFDILQPKEYFQLSRHTVIKMGSENEALDLSMKSVPWLKAGEVSPPIFQEDAALDLSVAAHRKSE.
For Research Use Only | Not For Clinical Use.
Online Inquiry