AibGenesis™ Mouse Anti-RALYL Antibody (MO-AB-05515W)


Cat: MO-AB-05515W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05515W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO05515W 100 µg
MO-AB-19020R Monoclonal Cattle (Bos taurus) WB, ELISA MO19020R 100 µg
MO-AB-28322H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28322C 100 µg
MO-AB-62916W Monoclonal Marmoset WB, ELISA MO62916W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO05515W
SpecificityThis antibody binds to Rhesus RALYL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RALYL Antibody is a mouse antibody against RALYL. It can be used for RALYL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNA-binding Raly-like protein isoform 1; RALYL
UniProt IDH9FQ35
Protein RefseqThe length of the protein is 304 amino acids long.
The sequence is show below: MSKRRRLKQGEPIMTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKVEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK.
For Research Use Only | Not For Clinical Use.
Online Inquiry