AibGenesis™ Mouse Anti-RANGRF Antibody (CBMOAB-56050FYA)


Cat: CBMOAB-56050FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56050FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56050FYA 100 µg
CBMOAB-95239FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95239FYA 100 µg
MO-AB-05517W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05517W 100 µg
MO-AB-06915H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06915C 100 µg
MO-AB-16584W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16584W 100 µg
MO-AB-19040R Monoclonal Cattle (Bos taurus) WB, ELISA MO19040R 100 µg
MO-AB-28338H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28338C 100 µg
MO-AB-62934W Monoclonal Marmoset WB, ELISA MO62934W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56050FYA
SpecificityThis antibody binds to Rhesus RANGRF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that has been shown to function as a guanine nucleotide release factor in mouse and to regulate the expression and function of the Nav1.5 cardiac sodium channel in human. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus RANGRF Antibody is a mouse antibody against RANGRF. It can be used for RANGRF detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRANGRF
UniProt IDF7FV47
Protein RefseqThe length of the protein is 186 amino acids long.
The sequence is show below: MEPMRDCPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVQGEAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGCCQEAWVLSGKQQIAKENQQVAKDVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPPHWSLGDFEQLVTSLTLHDPNIFGPQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry