AibGenesis™ Mouse Anti-RASAL1 Antibody (MO-AB-05544W)


Cat: MO-AB-05544W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05544W Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO05544W 100 µg
MO-AB-62970W Monoclonal Marmoset WB, ELISA MO62970W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO05544W
SpecificityThis antibody binds to Rhesus RASAL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. These proteins stimulate the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This particular family member contains domains which are characteristic of the GAP1 subfamily of RasGAP proteins but, in contrast to the other GAP1 family members, this protein is strongly and selectively expressed in endocrine tissues. Alternatively spliced transcript variants that encode different isoforms have been described. (From NCBI)
Product OverviewMouse Anti-Rhesus RASAL1 Antibody is a mouse antibody against RASAL1. It can be used for RASAL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRasGAP-activating-like protein 1 isoform 2; RASAL1
UniProt IDH9F498
Protein RefseqThe length of the protein is 181 amino acids long.
The sequence is show below: RVDEGAFQLPHVMQVVTQDGSGALHTTYLQCKNVNELNQWLSALRKASAPNPDKLAACHPGAFRSARWTCCLQAERSAAGCSRTHSAVTLGDWSDPLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTALEADTGACPEVLARQRAAAARLLEVLADLDRAHEEFQQQEREKVALGPLGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry