AibGenesis™ Mouse Anti-REEP6 Antibody (CBMOAB-56308FYA)


Cat: CBMOAB-56308FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56308FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56308FYA 100 µg
CBMOAB-95663FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95663FYA 100 µg
MO-AB-07032H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07032C 100 µg
MO-AB-14874W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14874W 100 µg
MO-AB-19186R Monoclonal Cattle (Bos taurus) WB, ELISA MO19186R 100 µg
MO-AB-28406H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28406C 100 µg
MO-AB-63169W Monoclonal Marmoset WB, ELISA MO63169W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56308FYA
SpecificityThis antibody binds to Rhesus REEP6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene may be involved in the transport of receptors from the endoplasmic reticulum (ER) to the cell surface. The encoded protein may also play a role in regulating ER membrane structure. This gene is required for the proper development of retinal rods and photoreceptors, with defects in this gene being associated with retinitis pigmentosa 77. (From NCBI)
Product OverviewMouse Anti-Rhesus REEP6 Antibody is a mouse antibody against REEP6. It can be used for REEP6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesReceptor expression-enhancing protein 6; REEP6
UniProt IDH9EZQ1
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MDGLSQRVERFLEQRNLVTDVLGALEAKTGLEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIVNNLSGRALDAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry