Mouse Anti-RESP18 Antibody (CBMOAB-56345FYA)


Cat: CBMOAB-56345FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56345FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO56345FYA 100 µg
MO-AB-19208R Monoclonal Cattle (Bos taurus) WB, ELISA MO19208R 100 µg
MO-AB-28421H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28421C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO56345FYA
SpecificityThis antibody binds to Rhesus RESP18.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRESP18 (Regulated Endocrine Specific Protein 18) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus RESP18 Antibody is a mouse antibody against RESP18. It can be used for RESP18 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRESP18
UniProt IDF7ES81
Protein RefseqThe length of the protein is 189 amino acids long.
The sequence is show below: MQHPLWPGGSEGLRLLVCFLLLNSCPGGCSDISAHDGQDQVGVEQLWPLQGFATPVFQHLQVVFQQILPQGLFWKDDITQDAMIQKMEHTSRLHPQDPCLKDGKAVFPTKTAGSPLAKVNRDQCFTSKVVSKVLKQEVANPVKTSYRRSYGGLDMMQALGASKEEIIYKIMHSLGLLWTISYCGPQPCG.
For Research Use Only | Not For Clinical Use.
Online Inquiry