AibGenesis™ Mouse Anti-RGNEF Antibody (MO-AB-05630W)


Cat: MO-AB-05630W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05630W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO05630W 100 µg
MO-AB-16335W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16335W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO05630W
SpecificityThis antibody binds to Rhesus RGNEF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RGNEF Antibody is a mouse antibody against RGNEF. It can be used for RGNEF detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRho-guanine nucleotide exchange factor isoform 1; RGNEF
UniProt IDH9FGQ7
Protein RefseqThe length of the protein is 72 amino acids long.
The sequence is show below: ILQYTKERTEEHKDLCKALCLIKDMIATVDLKVNEYEKNQKWLEILNKIENKTYTKLKNGHVFRKQALMSEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry