AibGenesis™ Mouse Anti-RNASE6 Antibody (CBMOAB-56572FYA)


Cat: CBMOAB-56572FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56572FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO56572FYA 100 µg
MO-AB-09740Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09740Y 100 µg
MO-AB-19333R Monoclonal Cattle (Bos taurus) WB, ELISA MO19333R 100 µg
MO-AB-26160W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26160W 100 µg
MO-AB-28538H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28538C 100 µg
MO-AB-28818R Monoclonal Pig (Sus scrofa) WB, ELISA MO28818R 100 µg
MO-AB-38118W Monoclonal Goat (Capra hircus) WB, ELISA MO38118W 100 µg
MO-AB-46346W Monoclonal Horse (Equus caballus) WB, ELISA MO46346W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO56572FYA
SpecificityThis antibody binds to Rhesus RNASE6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the ribonuclease A superfamily and functions in the urinary tract. The protein has broad-spectrum antimicrobial activity against pathogenic bacteria. (From NCBI)
Product OverviewMouse Anti-Rhesus RNASE6 Antibody is a mouse antibody against RNASE6. It can be used for RNASE6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibonuclease K6; RNASE6
UniProt IDH9YXN3
Protein RefseqThe length of the protein is 150 amino acids long.
The sequence is show below: MVLCFPLLLLLLVLWGPVCLLHAWPKHLTRAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIICKNRQHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry