AibGenesis™ Mouse Anti-RNF32 Antibody (CBMOAB-56662FYA)
Cat: CBMOAB-56662FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-56662FYA | Monoclonal | Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO56662FYA | 100 µg | ||
| CBMOAB-96221FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96221FYA | 100 µg | ||
| MO-AB-63441W | Monoclonal | Marmoset | WB, ELISA | MO63441W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO56662FYA |
| Specificity | This antibody binds to Rhesus RNF32. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. This gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids. Alternative splicing of this gene results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus RNF32 Antibody is a mouse antibody against RNF32. It can be used for RNF32 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | RING finger protein 32; RNF32 |
| UniProt ID | H9FJZ1 |
| Protein Refseq | The length of the protein is 66 amino acids long. The sequence is show below: KEEFELRPQVLLSCSHVFHRACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry