Mouse Anti-SAMD10 Antibody (CBMOAB-57085FYA)


Cat: CBMOAB-57085FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57085FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO57085FYA 100 µg
MO-AB-28804H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28804C 100 µg
MO-AB-63785W Monoclonal Marmoset WB, ELISA MO63785W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO57085FYA
SpecificityThis antibody binds to Rhesus SAMD10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SAMD10 Antibody is a mouse antibody against SAMD10. It can be used for SAMD10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSterile alpha motif domain-containing protein 10; SAMD10
UniProt IDH9Z5G2
Protein RefseqThe length of the protein is 202 amino acids long.
The sequence is show below: MFTELRSKLSPPRGRAGAVRAGFGERRDVDATAHFSFCQTLLEHTVSAESIPCHLPGTPGTSLTWHDSRSQRAASSRPIKLLQQPGTETPQGRLYSDHYGMYHTSPSLGGLTRPVVLWSQQDVCKWLKKHCPHNYLVYVEAFSQHAITGRALLRLNAEKLQRMGLAQEAQRQEVLQQVLRLQVREEGRSLQLLSQASFGKMS.
For Research Use Only | Not For Clinical Use.
Online Inquiry