AibGenesis™ Mouse Anti-SDPR Antibody (CBMOAB-57305FYA)
Cat: CBMOAB-57305FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-57305FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Marmoset | WB, ELISA | MO57305FYA | 100 µg | ||
| MO-AB-19866R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19866R | 100 µg | ||
| MO-AB-38162W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38162W | 100 µg | ||
| MO-AB-63994W | Monoclonal | Marmoset | WB, ELISA | MO63994W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Marmoset |
| Clone | MO57305FYA |
| Specificity | This antibody binds to Rhesus SDPR. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus SDPR Antibody is a mouse antibody against SDPR. It can be used for SDPR detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Serum deprivation-response protein; SDPR |
| UniProt ID | H9F2K5 |
| Protein Refseq | The length of the protein is 40 amino acids long. The sequence is show below: ALEQAQKVRYEGGYALTSEEAERSDEDPVQPAVLQVHQST. |
For Research Use Only | Not For Clinical Use.
Online Inquiry