AibGenesis™ Mouse Anti-SDPR Antibody (CBMOAB-57305FYA)


Cat: CBMOAB-57305FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57305FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Marmoset WB, ELISA MO57305FYA 100 µg
MO-AB-19866R Monoclonal Cattle (Bos taurus) WB, ELISA MO19866R 100 µg
MO-AB-38162W Monoclonal Goat (Capra hircus) WB, ELISA MO38162W 100 µg
MO-AB-63994W Monoclonal Marmoset WB, ELISA MO63994W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Marmoset
CloneMO57305FYA
SpecificityThis antibody binds to Rhesus SDPR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SDPR Antibody is a mouse antibody against SDPR. It can be used for SDPR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerum deprivation-response protein; SDPR
UniProt IDH9F2K5
Protein RefseqThe length of the protein is 40 amino acids long.
The sequence is show below: ALEQAQKVRYEGGYALTSEEAERSDEDPVQPAVLQVHQST.
For Research Use Only | Not For Clinical Use.
Online Inquiry