AibGenesis™ Mouse Anti-SDR9C7 Antibody (CBMOAB-57314FYA)


Cat: CBMOAB-57314FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57314FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO57314FYA 100 µg
MO-AB-05836W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05836W 100 µg
MO-AB-19871R Monoclonal Cattle (Bos taurus) WB, ELISA MO19871R 100 µg
MO-AB-63997W Monoclonal Marmoset WB, ELISA MO63997W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO57314FYA
SpecificityThis antibody binds to Rhesus SDR9C7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein with similarity to the short-chain dehydrogenase/reductase (SDR) family but has not been shown to have retinoid or dehydrogenase activities. (From NCBI)
Product OverviewMouse Anti-Rhesus SDR9C7 Antibody is a mouse antibody against SDR9C7. It can be used for SDR9C7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSDR9C7
UniProt IDF6Z3W7
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMRVLAACFTEEGAQKLQQDTSYRLQTTLLDVTKSESIKAAAQWLRDQVGEQGLWALVNNAGVGLPSGPNEWLTKEDFVKVINVNLVGLIEVTLHMLPMVKRARGRVINMSSCGGLVAVIGGGYCVSKFGVEAFSDSIRRKVFRGACRSCLLMGGTWWEVRLGLDSLLTSSRRLCLMQIAQRLLGQSGKRLNTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry