AibGenesis™ Mouse Anti-SEC14L4 Antibody (CBMOAB-57325FYA)


Cat: CBMOAB-57325FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57325FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO57325FYA 100 µg
Inquiry
MO-AB-19881R Monoclonal Cattle (Bos taurus) WB, ELISA MO19881R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO57325FYA
SpecificityThis antibody binds to Rhesus SEC14L4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus SEC14L4 Antibody is a mouse antibody against SEC14L4. It can be used for SEC14L4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSEC14L4
UniProt IDF6VSW3
Protein RefseqThe length of the protein is 406 amino acids long.
The sequence is show below: MSGRVGDLSPQQQEALARFRENLQNLLPMLPNADDYFLLRWLLARNFDLQKSEDMLRRHVEFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGSPVYFCIIGSLDPKGLLLSASKQDLIRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFGILEANYPETLKNLIIIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSFYLCNQVRLQYEHTVSVGRGSSLQVENEILFPGCVLRWQFASDGGDVGFGVFLKTKMGERQKAREMTEVLPSQRYNAHLVPEDGSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSLKAMRPSPTQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry