AibGenesis™ Mouse Anti-SELT Antibody (CBMOAB-57381FYA)


Cat: CBMOAB-57381FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57381FYA Monoclonal Rhesus (Macaca mulatta), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO57381FYA 100 µg
MO-AB-03083W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO03083W 100 µg
MO-AB-28915H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28915C 100 µg
MO-AB-29029R Monoclonal Pig (Sus scrofa) WB, ELISA MO29029R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO57381FYA
SpecificityThis antibody binds to Rhesus SELT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SELT Antibody is a mouse antibody against SELT. It can be used for SELT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSELT
UniProt IDF6U3K0
Protein RefseqThe length of the protein is 195 amino acids long.
The sequence is show below: MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQIWLECSYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry