Mouse Anti-Rhesus SET Antibody (MO-AB-05901W)


Cat: MO-AB-05901W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO05901W
SpecificityThis antibody binds to Rhesus SET.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus SET Antibody is a mouse antibody against SET. It can be used for SET detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein SET isoform 1; SET
UniProt IDH9ZCA2
Protein RefseqThe length of the protein is 290 amino acids long.
The sequence is show below: MAPKRQSPLLPQKKKPRPLPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD.
See other products for " SET "
MO-AB-13000WMouse Anti-Chimpanzee SET Antibody (MO-AB-13000W)
MO-AB-64185WMouse Anti-Marmoset SET Antibody (MO-AB-64185W)
MO-AB-07559HMouse Anti-Frog set Antibody (MO-AB-07559H)
CBMOAB-30821FYAMouse Anti-D. melanogaster Set Antibody (CBMOAB-30821FYA)
MO-AB-46500WMouse Anti-Horse SET Antibody (MO-AB-46500W)
MO-AB-20008RMouse Anti-Cattle SET Antibody (MO-AB-20008R)
For Research Use Only | Not For Clinical Use.
Online Inquiry