AibGenesis™ Mouse Anti-SHISA5 Antibody (CBMOAB-57720FYA)


Cat: CBMOAB-57720FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57720FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO57720FYA 100 µg
MO-AB-20108R Monoclonal Cattle (Bos taurus) WB, ELISA MO20108R 100 µg
MO-AB-25170W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25170W 100 µg
MO-AB-28973H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28973C 100 µg
MO-AB-64352W Monoclonal Marmoset WB, ELISA MO64352W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO57720FYA
SpecificityThis antibody binds to Rhesus SHISA5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the shisa family. The encoded protein is localized to the endoplasmic reticulum, and together with p53 induces apoptosis in a caspase-dependent manner. Alternative splicing results in multiple transcript variants. Related pseudogenes of this gene are found on chromosome X. (From NCBI)
Product OverviewMouse Anti-Rhesus SHISA5 Antibody is a mouse antibody against SHISA5. It can be used for SHISA5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSHISA5
UniProt IDF6T8L1
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: PVGSVPASVEPVEQLGSALRFRPGYSDPMLGFGATLAVGLTIFVLSVVAIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYVDAPKAAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry