AibGenesis™ Mouse Anti-SLAIN1 Antibody (CBMOAB-57852FYA)


Cat: CBMOAB-57852FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57852FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Rat (Rattus norvegicus) WB, ELISA MO57852FYA 100 µg
MO-AB-03985Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03985Y 100 µg
MO-AB-28994H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28994C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Rat (Rattus norvegicus)
CloneMO57852FYA
SpecificityThis antibody binds to Rhesus SLAIN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SLAIN1 Antibody is a mouse antibody against SLAIN1. It can be used for SLAIN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSLAIN1
UniProt IDF7HP96
Protein RefseqThe length of the protein is 349 amino acids long.
The sequence is show below: MEAARRSLCFRLEQGYTSRGSPLSPQSSIDSELSTSELEDDSISMGYKLQDLTDVQIMARLQEESLRQDYASTSASVSRHSSSVSLSSGKKGTCSDQEYDRYSLEDEEEFDHLPPPQPRLPRCSPFQRGIPHSQTFSSIRDCRRSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPSTTAISSNVSSPVTVRNSQSFDSSLHGAGNGISRIQSCIPSPGQLQHRVHSVGHFPVSIRQPLKATAYVSPTVQGSSNMPVSNGLQLYSNTGIPTPNKAAASGIMGRSALPRPSLAINGSNLPRSKIAQPVRSFLQPPKPLSSLSTLRDGNWRDGCY.
For Research Use Only | Not For Clinical Use.
Online Inquiry