AibGenesis™ Mouse Anti-SLC35D1 Antibody (CBMOAB-58179FYA)


Cat: CBMOAB-58179FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58179FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO58179FYA 100 µg
MO-AB-11893W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11893W 100 µg
MO-AB-64631W Monoclonal Marmoset WB, ELISA MO64631W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO58179FYA
SpecificityThis antibody binds to Rhesus SLC35D1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SLC35D1 Antibody is a mouse antibody against SLC35D1. It can be used for SLC35D1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUDP-glucuronic acid/UDP-N-acetylgalactosamine transporter; SLC35D1
UniProt IDH9F0J9
Protein RefseqThe length of the protein is 209 amino acids long.
The sequence is show below: MAEVHRRQHARVKGEAPAKSSTLRDEEELGMASAETLTVFLKLLAAGFYGVSSFLIVVVNKSVLTNYRFPSSLCVGLGQMVATVAVLWVGKALRVVKFPDLDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGVLLKKTFSWGIKMTVFAMIIGAFVAASSDLAFDLEGYVFILINDVLTAANGAYVKQKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry