AibGenesis™ Mouse Anti-SMLR1 Antibody (MO-AB-06145W)


Cat: MO-AB-06145W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06145W Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO06145W 100 µg
MO-AB-29041H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29041C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO06145W
SpecificityThis antibody binds to Rhesus SMLR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SMLR1 Antibody is a mouse antibody against SMLR1. It can be used for SMLR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSmall Leucine Rich Protein 1
UniProt IDG7MQD8
Protein RefseqThe length of the protein is 107 amino acids long.
The sequence is show below: MLNKGQSSRRKQVQPQSKVALVPTVTPTVPVGSVWLAMGSILSAFMRELPGWFLFSGVFLPVTLLLLLLIAYFRIKLIEVNEELSQTCDRQHNPKDGSSLYRRMKWT.
For Research Use Only | Not For Clinical Use.
Online Inquiry