AibGenesis™ Mouse Anti-SPATA24 Antibody (CBMOAB-58866FYA)


Cat: CBMOAB-58866FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58866FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO58866FYA 100 µg
MO-AB-14107W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14107W 100 µg
MO-AB-29136H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29136C 100 µg
MO-AB-30376R Monoclonal Pig (Sus scrofa) WB, ELISA MO30376R 100 µg
MO-AB-65174W Monoclonal Marmoset WB, ELISA MO65174W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO58866FYA
SpecificityThis antibody binds to Rhesus SPATA24.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SPATA24 Antibody is a mouse antibody against SPATA24. It can be used for SPATA24 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSpermatogenesis-associated protein 24; SPATA24
UniProt IDH9F0G7
Protein RefseqThe length of the protein is 183 amino acids long.
The sequence is show below: MATPLGWSKAGSGSVCLAFDQLRDVIESQEELIHQLRNVMVLQDENFVSKEEFQAVEKKLVEEKAAHAKTKVLLAKEEEKLQFALGEVEVLSKQLEKEKLAFEKALSSVKSKVLQESSKKDQLITKCNEIESHIIKQEDILNGKENEIKELQQVISQQKQIFRNHMSDFRIQKQQESYMAQVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry