AibGenesis™ Mouse Anti-STARD6 Antibody (CBMOAB-59243FYA)


Cat: CBMOAB-59243FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59243FYA Monoclonal Rhesus (Macaca mulatta), Horse (Equus caballus), Rat (Rattus norvegicus) WB, ELISA MO59243FYA 100 µg
MO-AB-29242H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29242C 100 µg
MO-AB-46707W Monoclonal Horse (Equus caballus) WB, ELISA MO46707W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Horse (Equus caballus), Rat (Rattus norvegicus)
CloneMO59243FYA
SpecificityThis antibody binds to Rhesus STARD6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus STARD6 Antibody is a mouse antibody against STARD6. It can be used for STARD6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSTARD6
UniProt IDF7GLT4
Protein RefseqThe length of the protein is 220 amino acids long.
The sequence is show below: MDYKAIAQKTVQEVLGYTQDTSGWKVVKISKKITVSSKASRKFHGNLYRVEGIIPESAAKLSDFLYQTGERVTWDKSLQVYDMVHRIDSDTFICHTITQSFAMGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMKENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHKTPSGRGFRHNSHS.
For Research Use Only | Not For Clinical Use.
Online Inquiry