AibGenesis™ Mouse Anti-SWSAP1 Antibody (CBMOAB-59520FYA)


Cat: CBMOAB-59520FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59520FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO59520FYA 100 µg
MO-AB-06346W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06346W 100 µg
MO-AB-29305H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29305C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO59520FYA
SpecificityThis antibody binds to Rhesus SWSAP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SWSAP1 Antibody is a mouse antibody against SWSAP1. It can be used for SWSAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSWSAP1
UniProt IDF7GQA9
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: AAAGPPLLLLGAPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSLPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVALQTQKEADSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLDPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP.
For Research Use Only | Not For Clinical Use.
Online Inquiry